Nexilin antibody

Name Nexilin antibody
Supplier Fitzgerald
Catalog 70R-2949
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen Nexilin antibody was raised using a synthetic peptide corresponding to a region with amino acids EELERQRQENRKKQAEEEARKRLEEEKRAFEEARRQMVNEDEENQDTAKI
Purity/Format Affinity purified
Blocking Peptide Nexilin Blocking Peptide
Description Rabbit polyclonal Nexilin antibody
Gene NEXN
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.