| Name | SNF1LK antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1185 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | SNF1LK antibody was raised using the N terminal of SNF1LK corresponding to a region with amino acids MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTK |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | SNF1LK Blocking Peptide |
| Description | Rabbit polyclonal SNF1LK antibody raised against the N terminal of SNF1LK |
| Gene | SIK1 |
| Supplier Page | Shop |