| Name | PCGF6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2762 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PCGF6 antibody was raised using the middle region of PCGF6 corresponding to a region with amino acids TQPLYNISANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | PCGF6 Blocking Peptide |
| Description | Rabbit polyclonal PCGF6 antibody raised against the middle region of PCGF6 |
| Gene | PCGF6 |
| Supplier Page | Shop |