PSMG1 antibody

Name PSMG1 antibody
Supplier Fitzgerald
Catalog 70R-3339
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen PSMG1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TILTCRHVTDYKTSESTGSLPSPFLRALKTQNFKDSACCPLLEQPNIVHD
Purity/Format Affinity purified
Blocking Peptide PSMG1 Blocking Peptide
Description Rabbit polyclonal PSMG1 antibody
Gene PSMG1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.