| Name | FES antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5774 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | FES antibody was raised using the N terminal of FES corresponding to a region with amino acids ARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQL |
| Purity/Format | Affinity purified |
| Blocking Peptide | FES Blocking Peptide |
| Description | Rabbit polyclonal FES antibody raised against the N terminal of FES |
| Gene | FDPS |
| Supplier Page | Shop |