PIGZ antibody

Name PIGZ antibody
Supplier Fitzgerald
Catalog 70R-7100
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen PIGZ antibody was raised using the N terminal of PIGZ corresponding to a region with amino acids VLWGGLSLLRVLWCLLPQTGYVHPDEFFQSPEVMAEDILGVQAARPWEFY
Purity/Format Affinity purified
Blocking Peptide PIGZ Blocking Peptide
Description Rabbit polyclonal PIGZ antibody raised against the N terminal of PIGZ
Gene PIGZ
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.