| Name | PIGZ antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7100 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PIGZ antibody was raised using the N terminal of PIGZ corresponding to a region with amino acids VLWGGLSLLRVLWCLLPQTGYVHPDEFFQSPEVMAEDILGVQAARPWEFY |
| Purity/Format | Affinity purified |
| Blocking Peptide | PIGZ Blocking Peptide |
| Description | Rabbit polyclonal PIGZ antibody raised against the N terminal of PIGZ |
| Gene | PIGZ |
| Supplier Page | Shop |