| Name | PIGW antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6939 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PIGW antibody was raised using the middle region of PIGW corresponding to a region with amino acids IALGITVLYQLALDFTSLKRLILYGTDGSGTRVGLLNANREGIISTLGYV |
| Purity/Format | Affinity purified |
| Blocking Peptide | PIGW Blocking Peptide |
| Description | Rabbit polyclonal PIGW antibody raised against the middle region of PIGW |
| Gene | PIGW |
| Supplier Page | Shop |