| Name | KCNIP2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5100 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat, Dog |
| Antigen | KCNIP2 antibody was raised using the N terminal of KCNIP2 corresponding to a region with amino acids PEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQG |
| Purity/Format | Affinity purified |
| Blocking Peptide | KCNIP2 Blocking Peptide |
| Description | Rabbit polyclonal KCNIP2 antibody raised against the N terminal of KCNIP2 |
| Gene | KCNIP2 |
| Supplier Page | Shop |