| Name | NELF antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2570 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | NELF antibody was raised using the N terminal of NELF corresponding to a region with amino acids GAAASRRRALRSEAMSSVAAKVRAARAFGEYLSQSHPENRNGADHLLADA |
| Purity/Format | Affinity purified |
| Blocking Peptide | NELF Blocking Peptide |
| Description | Rabbit polyclonal NELF antibody raised against the N terminal of NELF |
| Gene | NSMF |
| Supplier Page | Shop |