| Name | HBXIP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2217 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | HBXIP antibody was raised using the N terminal of HBXIP corresponding to a region with amino acids EPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLR |
| Purity/Format | Affinity purified |
| Blocking Peptide | HBXIP Blocking Peptide |
| Description | Rabbit polyclonal HBXIP antibody raised against the N terminal of HBXIP |
| Gene | LAMTOR5 |
| Supplier Page | Shop |