DIRAS1 antibody

Name DIRAS1 antibody
Supplier Fitzgerald
Catalog 70R-5870
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen DIRAS1 antibody was raised using the middle region of DIRAS1 corresponding to a region with amino acids KCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVK
Purity/Format Affinity purified
Blocking Peptide DIRAS1 Blocking Peptide
Description Rabbit polyclonal DIRAS1 antibody raised against the middle region of DIRAS1
Gene DKK3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.