| Name | AGK antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3532 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | AGK antibody was raised using the N terminal of AGK corresponding to a region with amino acids KKLLELMENTDVIIVAGGDGTLQEVVTGVLRRTDEATFSKIPIGFIPLGE |
| Purity/Format | Affinity purified |
| Blocking Peptide | AGK Blocking Peptide |
| Description | Rabbit polyclonal AGK antibody raised against the N terminal of AGK |
| Gene | AGK |
| Supplier Page | Shop |