PRMT2 antibody

Name PRMT2 antibody
Supplier Fitzgerald
Catalog 70R-2062
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen PRMT2 antibody was raised using the N terminal of PRMT2 corresponding to a region with amino acids ERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQP
Purity/Format Affinity purified
Blocking Peptide PRMT2 Blocking Peptide
Description Rabbit polyclonal PRMT2 antibody raised against the N terminal of PRMT2
Gene PRMT2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.