MPP5 antibody

Name MPP5 antibody
Supplier Fitzgerald
Catalog 70R-2478
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen MPP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSM
Purity/Format Affinity purified
Blocking Peptide MPP5 Blocking Peptide
Description Rabbit polyclonal MPP5 antibody
Gene MPP5
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.