Name | MAS1 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1838 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | IHC WB |
Species Reactivities | Human |
Antigen | MAS1 antibody was raised using the middle region of MAS1 corresponding to a region with amino acids RPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHSRNDCRAVIIFIAI |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | MAS1 Blocking Peptide |
Description | Rabbit polyclonal MAS1 antibody raised against the middle region of MAS1 |
Gene | MAS1 |
Supplier Page | Shop |