ABCC11 antibody

Name ABCC11 antibody
Supplier Fitzgerald
Catalog 70R-6719
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen ABCC11 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSKIILIDEATASIDMETDTLIQRTIREAFQGCTVLVIAHRVTTVLNCDH
Purity/Format Affinity purified
Blocking Peptide ABCC11 Blocking Peptide
Description Rabbit polyclonal ABCC11 antibody
Gene ABCC11
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.