| Name | KCNAB1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5041 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | KCNAB1 antibody was raised using the C terminal of KCNAB1 corresponding to a region with amino acids VPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAV |
| Purity/Format | Affinity purified |
| Blocking Peptide | KCNAB1 Blocking Peptide |
| Description | Rabbit polyclonal KCNAB1 antibody raised against the C terminal of KCNAB1 |
| Gene | KCNAB1 |
| Supplier Page | Shop |