C6ORF150 antibody

Name C6ORF150 antibody
Supplier Fitzgerald
Catalog 70R-4145
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen C6ORF150 antibody was raised using the middle region of C6Orf150 corresponding to a region with amino acids VPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDC
Purity/Format Affinity purified
Blocking Peptide C6ORF150 Blocking Peptide
Description Rabbit polyclonal C6ORF150 antibody raised against the middle region of C6Orf150
Gene MB21D1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.