OSTalpha antibody

Name OSTalpha antibody
Supplier Fitzgerald
Catalog 70R-4593
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen OSTalpha antibody was raised using the middle region of OSTalpha corresponding to a region with amino acids LLMLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVS
Purity/Format Affinity purified
Blocking Peptide OSTalpha Blocking Peptide
Description Rabbit polyclonal OSTalpha antibody raised against the middle region of OSTalpha
Gene SLC51A
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.