Name | TNRC6B antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4881 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | TNRC6B antibody was raised using the N terminal of TNRC6B corresponding to a region with amino acids LQSESGTAPVWSKSTPPAPDNGTSAWGEPNESSPGWGEMDDTGASTTGWG |
Purity/Format | Affinity purified |
Blocking Peptide | TNRC6B Blocking Peptide |
Description | Rabbit polyclonal TNRC6B antibody raised against the N terminal of TNRC6B |
Gene | TNRC6B |
Supplier Page | Shop |