PNRC2 antibody

Name PNRC2 antibody
Supplier Fitzgerald
Catalog 70R-3985
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen PNRC2 antibody was raised using the middle region of PNRC2 corresponding to a region with amino acids NQSWNSSLSGPRLLFKSQANQNYAGAKFSEPPSPSVLPKPPSHWVPVSFN
Purity/Format Affinity purified
Blocking Peptide PNRC2 Blocking Peptide
Description Rabbit polyclonal PNRC2 antibody raised against the middle region of PNRC2
Gene PNRC2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.