| Name | PPAPDC2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6944 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PPAPDC2 antibody was raised using the N terminal of PPAPDC2 corresponding to a region with amino acids MPSPRRSMEGRPLGVSASSSSSSPGSPAHGGGGGGSRFEFQSLLSSRATA |
| Purity/Format | Affinity purified |
| Blocking Peptide | PPAPDC2 Blocking Peptide |
| Description | Rabbit polyclonal PPAPDC2 antibody raised against the N terminal of PPAPDC2 |
| Gene | PPAPDC2 |
| Supplier Page | Shop |