| Name | PSMB5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2350 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PSMB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids IVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | PSMB5 Blocking Peptide |
| Description | Rabbit polyclonal PSMB5 antibody |
| Gene | PSMB5 |
| Supplier Page | Shop |