| Name | FBXL5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2735 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FBXL5 antibody was raised using the middle region of FBXL5 corresponding to a region with amino acids LRTMSSLPESSAMCRKAARTRLPRGKDLIYFGSEKSDQETGRVLLFLSLS |
| Purity/Format | Affinity purified |
| Blocking Peptide | FBXL5 Blocking Peptide |
| Description | Rabbit polyclonal FBXL5 antibody raised against the middle region of FBXL5 |
| Gene | FBXL5 |
| Supplier Page | Shop |