| Name | ATP5B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1099 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | ATP5B antibody was raised using the N terminal of ATP5B corresponding to a region with amino acids PIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQ |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | ATP5B Blocking Peptide |
| Description | Rabbit polyclonal ATP5B antibody raised against the N terminal of ATP5B |
| Gene | ATP5B |
| Supplier Page | Shop |