Name | Klotho antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-7522 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Klotho antibody was raised using the middle region of KL corresponding to a region with amino acids HRGYSIRRGLFYVDFLSQDKMLLPKSSALFYQKLIEKNGFPPLPENQPLE |
Purity/Format | Affinity purified |
Blocking Peptide | Klotho Blocking Peptide |
Description | Rabbit polyclonal KL antibody raised against the middle region of KL |
Gene | KL |
Supplier Page | Shop |