| Name | RFFL antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2767 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | RFFL antibody was raised using the middle region of RFFL corresponding to a region with amino acids KDQKGLQHLVSGAEDQNGGAVPSGLEENLCKICMDSPIDCVLLECGHMVT |
| Purity/Format | Affinity purified |
| Blocking Peptide | RFFL Blocking Peptide |
| Description | Rabbit polyclonal RFFL antibody raised against the middle region of RFFL |
| Gene | RFFL |
| Supplier Page | Shop |