| Name | RBJ antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5875 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RBJ antibody was raised using the middle region of RBJ corresponding to a region with amino acids CVDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYISIVDLCENGGKR |
| Purity/Format | Affinity purified |
| Blocking Peptide | RBJ Blocking Peptide |
| Description | Rabbit polyclonal RBJ antibody raised against the middle region of RBJ |
| Gene | DNAJC27 |
| Supplier Page | Shop |