| Name | Carboxypeptidase E antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5331 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | Carboxypeptidase E antibody was raised using the N terminal of CPE corresponding to a region with amino acids GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG |
| Purity/Format | Affinity purified |
| Blocking Peptide | Carboxypeptidase E Blocking Peptide |
| Description | Rabbit polyclonal Carboxypeptidase E antibody raised against the N terminal of CPE |
| Gene | CPE |
| Supplier Page | Shop |