TRPV4 antibody

Name TRPV4 antibody
Supplier Fitzgerald
Catalog 70R-5169
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen TRPV4 antibody was raised using the middle region of TRPV4 corresponding to a region with amino acids RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR
Purity/Format Affinity purified
Blocking Peptide TRPV4 Blocking Peptide
Description Rabbit polyclonal TRPV4 antibody raised against the middle region of TRPV4
Gene TRPV4
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.