| Name | DHFRL1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4081 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | DHFRL1 antibody was raised using the middle region of DHFRL1 corresponding to a region with amino acids RINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSS |
| Purity/Format | Affinity purified |
| Blocking Peptide | DHFRL1 Blocking Peptide |
| Description | Rabbit polyclonal DHFRL1 antibody raised against the middle region of DHFRL1 |
| Gene | DHFRL1 |
| Supplier Page | Shop |