| Name | U2AF1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4817 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Drosophila |
| Antigen | U2AF1 antibody was raised using the N terminal of U2AF1 corresponding to a region with amino acids MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQN |
| Purity/Format | Affinity purified |
| Blocking Peptide | U2AF1 Blocking Peptide |
| Description | Rabbit polyclonal U2AF1 antibody raised against the N terminal of U2AF1 |
| Gene | U2AF1 |
| Supplier Page | Shop |