CHN2 antibody

Name CHN2 antibody
Supplier Fitzgerald
Catalog 70R-2836
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen CHN2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AFGVKVGVKGGFLWPPLKLFACSQISSLVRRAALTHNDNHFNYEKTHNFK
Purity/Format Affinity purified
Blocking Peptide CHN2 Blocking Peptide
Description Rabbit polyclonal CHN2 antibody
Gene NKX2-1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.