| Name | SCN1B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5206 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Dog |
| Antigen | SCN1B antibody was raised using the middle region of SCN1B corresponding to a region with amino acids NVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVS |
| Purity/Format | Affinity purified |
| Blocking Peptide | SCN1B Blocking Peptide |
| Description | Rabbit polyclonal SCN1B antibody raised against the middle region of SCN1B |
| Gene | SCN1B |
| Supplier Page | Shop |