PCDH8 antibody

Name PCDH8 antibody
Supplier Fitzgerald
Catalog 70R-6180
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen PCDH8 antibody was raised using the middle region of PCDH8 corresponding to a region with amino acids GATSLVPEGAARESLVALVSTSDRDSGANGQVRCALYGHEHFRLQPAYAG
Purity/Format Affinity purified
Blocking Peptide PCDH8 Blocking Peptide
Description Rabbit polyclonal PCDH8 antibody raised against the middle region of PCDH8
Gene PCDH8
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.