CUGBP2 antibody

Name CUGBP2 antibody
Supplier Fitzgerald
Catalog 70R-4886
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen CUGBP2 antibody was raised using the N terminal of CUGBP2 corresponding to a region with amino acids TSAFKLDFLPDMMVEGRLLVPDRINGTANKMNGALDHSDQPDPDAIKMFV
Purity/Format Affinity purified
Blocking Peptide CUGBP2 Blocking Peptide
Description Rabbit polyclonal CUGBP2 antibody raised against the N terminal of CUGBP2
Gene CELF2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.