Name | EXOSC3 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4694 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | IHC WB |
Species Reactivities | Human, Mouse, Rat, Dog |
Antigen | EXOSC3 antibody was raised using the middle region of EXOSC3 corresponding to a region with amino acids TKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFK |
Purity/Format | Affinity purified |
Blocking Peptide | EXOSC3 Blocking Peptide |
Description | Rabbit polyclonal EXOSC3 antibody raised against the middle region of EXOSC3 |
Gene | EXOSC3 |
Supplier Page | Shop |