EXOSC3 antibody

Name EXOSC3 antibody
Supplier Fitzgerald
Catalog 70R-4694
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human, Mouse, Rat, Dog
Antigen EXOSC3 antibody was raised using the middle region of EXOSC3 corresponding to a region with amino acids TKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFK
Purity/Format Affinity purified
Blocking Peptide EXOSC3 Blocking Peptide
Description Rabbit polyclonal EXOSC3 antibody raised against the middle region of EXOSC3
Gene EXOSC3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.