| Name | STRAP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2067 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | STRAP antibody was raised using the N terminal of STRAP corresponding to a region with amino acids HIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKAL |
| Purity/Format | Affinity purified |
| Blocking Peptide | STRAP Blocking Peptide |
| Description | Rabbit polyclonal STRAP antibody raised against the N terminal of STRAP |
| Gene | STRAP |
| Supplier Page | Shop |