| Name | PTPRH antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7142 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PTPRH antibody was raised using the middle region of PTPRH corresponding to a region with amino acids QTKNSVMLWWKAPGDPHSQLYVYWVQWASKGHPRRGQDPQANWVNQTSRT |
| Purity/Format | Affinity purified |
| Blocking Peptide | PTPRH Blocking Peptide |
| Description | Rabbit polyclonal PTPRH antibody raised against the middle region of PTPRH |
| Gene | PTPRH |
| Supplier Page | Shop |