TM7SF2 antibody

Name TM7SF2 antibody
Supplier Fitzgerald
Catalog 70R-6436
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen TM7SF2 antibody was raised using the N terminal of TM7SF2 corresponding to a region with amino acids LAARSGPARLLGPPASLPGLEVLWSPRALLLWLAWLGLQAALYLLPARKV
Purity/Format Affinity purified
Blocking Peptide TM7SF2 Blocking Peptide
Description Rabbit polyclonal TM7SF2 antibody raised against the N terminal of TM7SF2
Gene TM7SF2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.