Name | ZGPAT antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3510 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | ZGPAT antibody was raised using the C terminal of ZGPAT corresponding to a region with amino acids AGRHSVASAQLQEKLAGAQRQLGQLRAQEAGLQQEQRKADTHKKMTEF |
Purity/Format | Affinity purified |
Blocking Peptide | ZGPAT Blocking Peptide |
Description | Rabbit polyclonal ZGPAT antibody raised against the C terminal of ZGPAT |
Gene | ZGPAT |
Supplier Page | Shop |