| Name | ZGPAT antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3510 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ZGPAT antibody was raised using the C terminal of ZGPAT corresponding to a region with amino acids AGRHSVASAQLQEKLAGAQRQLGQLRAQEAGLQQEQRKADTHKKMTEF |
| Purity/Format | Affinity purified |
| Blocking Peptide | ZGPAT Blocking Peptide |
| Description | Rabbit polyclonal ZGPAT antibody raised against the C terminal of ZGPAT |
| Gene | ZGPAT |
| Supplier Page | Shop |