HACE1 antibody

Name HACE1 antibody
Supplier Fitzgerald
Catalog 70R-2804
Prices $375.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen HACE1 antibody was raised using the middle region of HACE1 corresponding to a region with amino acids DVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRV
Purity/Format Affinity purified
Blocking Peptide HACE1 Blocking Peptide
Description Rabbit polyclonal HACE1 antibody raised against the middle region of HACE1
Gene HACE1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.