Name | NOX1 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-7398 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Dog |
Antigen | NOX1 antibody was raised using the C terminal of NOX1 corresponding to a region with amino acids STIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF |
Purity/Format | Affinity purified |
Blocking Peptide | NOX1 Blocking Peptide |
Description | Rabbit polyclonal NOX1 antibody raised against the C terminal of NOX1 |
Gene | NOX1 |
Supplier Page | Shop |