CHMP1B antibody

Name CHMP1B antibody
Supplier Fitzgerald
Catalog 70R-4086
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen CHMP1B antibody was raised using the N terminal of CHMP1B corresponding to a region with amino acids KIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVT
Purity/Format Affinity purified
Blocking Peptide CHMP1B Blocking Peptide
Description Rabbit polyclonal CHMP1B antibody raised against the N terminal of CHMP1B
Gene CHMP1B
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.