RP11-82K18.3 antibody

Name RP11-82K18.3 antibody
Supplier Fitzgerald
Catalog 70R-1302
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen RP11-82K18.3 antibody was raised using the N terminal Of Rp11-82K18.3 corresponding to a region with amino acids SGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLAA
Purity/Format Total IgG Protein A purified
Blocking Peptide RP11-82K18.3 Blocking Peptide
Description Rabbit polyclonal RP11-82K18.3 antibody raised against the N terminal Of Rp11-82K18.3
Gene CCBL2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.