GABARAPL1 antibody

Name GABARAPL1 antibody
Supplier Fitzgerald
Catalog 70R-3001
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen GABARAPL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTI
Purity/Format Affinity purified
Blocking Peptide GABARAPL1 Blocking Peptide
Description Rabbit polyclonal GABARAPL1 antibody
Gene GABARAPL1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.