| Name | RHOU antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5757 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | RHOU antibody was raised using the C terminal of RHOU corresponding to a region with amino acids LKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV |
| Purity/Format | Affinity purified |
| Blocking Peptide | RHOU Blocking Peptide |
| Description | Rabbit polyclonal RHOU antibody raised against the C terminal of RHOU |
| Gene | RHOU |
| Supplier Page | Shop |