Name | RAB22A antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4379 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | RAB22A antibody was raised using the middle region of RAB22A corresponding to a region with amino acids IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS |
Purity/Format | Affinity purified |
Blocking Peptide | RAB22A Blocking Peptide |
Description | Rabbit polyclonal RAB22A antibody raised against the middle region of RAB22A |
Gene | RAB22A |
Supplier Page | Shop |