| Name | RAB22A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4379 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | RAB22A antibody was raised using the middle region of RAB22A corresponding to a region with amino acids IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS |
| Purity/Format | Affinity purified |
| Blocking Peptide | RAB22A Blocking Peptide |
| Description | Rabbit polyclonal RAB22A antibody raised against the middle region of RAB22A |
| Gene | RAB22A |
| Supplier Page | Shop |