Anti-CED6 antibody
| Name | Anti-CED6 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab133825 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within the N terminal amino acids 29-78 (AKFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKIPKVELQISIY G) of Human GULP1 (NP_057399) |
| Description | Rabbit Polyclonal |
| Gene | GULP1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-CED6 antibody (ab133825) at 1 µg/ml + Human fetal brain lysate at 10 µg