Anti-CGBP antibody
| Name | Anti-CGBP antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab87288 |
| Prices | $376.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Goat, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 432-481 ( RIRREQQSARTRLQEMERRFHELEAIILRAKQQAVREDEESNEGDSDDTD ) of Human CGBP (NP_055408) |
| Description | Rabbit Polyclonal |
| Gene | CXXC1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-CGBP antibody (ab87288) at 1 µg/ml + THP-1 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution